PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00011g00209.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family ZF-HD
Protein Properties Length: 304aa    MW: 34147.7 Da    PI: 7.77
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00011g00209.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.65.5e-3275132260
               ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                               + vrYkeClkNhAa++Gg+a+DGCgEfmps geegt +al C+AC+CHRnFHR+e e e
  Peaxi162Scf00011g00209.1  75 KMVRYKECLKNHAATMGGNATDGCGEFMPS-GEEGTLEALICSACNCHRNFHRKEIEGE 132
                               679**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.9E-2977129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257749.0E-2577132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.8E-3178129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.27879128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.2E-30222291IPR009057Homeodomain-like
SuperFamilySSF466894.13E-19222290IPR009057Homeodomain-like
TIGRFAMsTIGR015654.7E-27229285IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MELPNQEEEM PLPINSTYVG GVHQHGHGHI IHHDPTPPNS NTNHIIPSSV APPSMNGPPI  60
DAAPVASDHH LPYKKMVRYK ECLKNHAATM GGNATDGCGE FMPSGEEGTL EALICSACNC  120
HRNFHRKEIE GEQQLLQQQA LPSPCDYYHL NRVGKKVYLG SHHHKSLLGP ESFGTIIPSR  180
PAPHQMIMSY NMGSLPNSES EEHEDGLGNG GVMAMAMARP LHHHHQNVKK RFRTKFTQEQ  240
KEKMLNFAEK VGWKIQKQEE AVVQQFCQEV GVKRRVLKVW MHNNKHNLAK KNNDSNNIIP  300
QDHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-242302871875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755138e-56HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
GenBankHG9754408e-56HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613099.11e-165PREDICTED: zinc-finger homeodomain protein 4
RefseqXP_016501840.11e-165PREDICTED: zinc-finger homeodomain protein 4-like
RefseqXP_016501841.11e-165PREDICTED: zinc-finger homeodomain protein 4-like
SwissprotQ9M9S05e-77ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLK4B1M41e-149K4B1M4_SOLLC; Uncharacterized protein
STRINGSolyc01g102980.2.11e-148(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51542338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-70homeobox protein 31