PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00001g04119.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family FAR1
Protein Properties Length: 422aa    MW: 49341.3 Da    PI: 8.3629
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00001g04119.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR162.21.5e-192699177
                      FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwe 77
                              +fY +YA++ GFsv +s+ ++s+++++i+ ++fvCskeg+r++++ +   ++r+r etr gCk ++ ++k+++g w+
  Peaxi162Scf00001g04119.1 26 EFYLNYAHRSGFSVHRSRISRSRKDNSIIGQQFVCSKEGFRSKKSLE---SNRQRDETREGCKVMIYLSKKEEGMWM 99
                              6******************************************9877...9999*********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.9E-172699IPR004330FAR1 DNA binding domain
PfamPF105511.0E-33217311IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MNVTVDEEPR EPYIGMDFPS PDIAFEFYLN YAHRSGFSVH RSRISRSRKD NSIIGQQFVC  60
SKEGFRSKKS LESNRQRDET REGCKVMIYL SKKEEGMWMQ KFLRSKRKKS EAQKNLIDLL  120
DTSGVRPSKI ASVLINQAGG VENLNLTGRD IQNYLSTKRQ NNLEKGDAQL MLKYFQKHQS  180
ENPGFFYAIQ MDIEGHLANC FWVDARSRVV YKNFGEVVVF DPTYLTNKYM MPFVPFTGVN  240
NHHQSILFGC ALLWDETEEI FVWLLRTWKE AMFGVASRTI ITDQDQAITN AVAKVFPNSA  300
HHFCMWHIEK KIPEYLSHIY HEFGDFKTKF SKCLHDTTTP EEFEIAWKDI MKLYNLEENS  360
WLQRIYAIRE KWIPSYVCTT FCAGMSTTQR SESMNKFFKD YLNSSTPMSV FVTQYDKAVD  420
AR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025886302.10.0protein FAR1-RELATED SEQUENCE 5-like
TrEMBLD5MNY60.0D5MNY6_SOLLC; Transposon-like element Lyt2-2 DNA
STRINGSolyc01g110070.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-113FAR1-related sequence 5