PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00000g00481.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family NAC
Protein Properties Length: 290aa    MW: 32663.6 Da    PI: 9.8776
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00000g00481.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM101.41.2e-31108354128
                       NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  Peaxi162Scf00000g00481.1  10 GEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVIST-QGKKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 83 
                               689*********************************99999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.9761106IPR003441NAC domain
SuperFamilySSF1019419.94E-425107IPR003441NAC domain
PfamPF023655.6E-151383IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MTSRGKAIFG EKEWYFFSPR DRKYPNGSRP NRVAGSGYWK ATGTDKVIST QGKKVGIKKA  60
LVFYVGKAPK GTKTNWIMHE YRLIEPSRKT GSSKLDEWVL CRIYKKNSSG QKPQVSGLQS  120
KEYSHGSSTS SSSQFDDMLE SLPEMDDRIQ RLNSLKPFQQ GERLNLERLD SANFDWAILA  180
GLKPMPELGP ATQGPGVPSQ GLVNNIHNHN SNNNMNFLND VYVQPTNFRG ITKVENVVDE  240
EVESGIRNQR FDKSGYFQQN VNGFSQTYTN AVDQFTIQCP NQTLNLGFGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-67611268174NAC domain-containing protein 19
3swm_B1e-67611268174NAC domain-containing protein 19
3swm_C1e-67611268174NAC domain-containing protein 19
3swm_D1e-67611268174NAC domain-containing protein 19
3swp_A1e-67611268174NAC domain-containing protein 19
3swp_B1e-67611268174NAC domain-containing protein 19
3swp_C1e-67611268174NAC domain-containing protein 19
3swp_D1e-67611268174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233972.11e-154jasmonic acid 2
RefseqXP_009618124.11e-154PREDICTED: NAC domain-containing protein 72-like
RefseqXP_016440048.11e-154PREDICTED: NAC domain-containing protein 72-like
SwissprotQ9SQL01e-155JA2_SOLLC; NAC domain-containing protein JA2
TrEMBLA0A1S3XJF81e-153A0A1S3XJF8_TOBAC; NAC domain-containing protein 72-like
STRINGSolyc12g013620.1.11e-154(Solanum lycopersicum)
STRINGXP_009618124.11e-153(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.32e-81NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]