PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9924708g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 172aa    MW: 19514.1 Da    PI: 4.9967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9924708g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.73.5e-42201191100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaC++lrr+C+k+C +apyfp ++p+kf  vh++FGasn+ k+l++lp ++r+da+ss+vyeA+ar+rdPvyG++g i +lq+q+ +l+++l
  MA_9924708g0010  20 PCAACRLLRRRCSKECNFAPYFPRDDPQKFSSVHRIFGASNINKMLQDLPINQRSDAVSSMVYEAHARIRDPVYGCAGAICSLQKQMLELQSQL 113
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+++e
  MA_9924708g0010 114 ALAQAE 119
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.93519120IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4120117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MDESGRPPAD CRKTTEVMSP CAACRLLRRR CSKECNFAPY FPRDDPQKFS SVHRIFGASN  60
INKMLQDLPI NQRSDAVSSM VYEAHARIRD PVYGCAGAIC SLQKQMLELQ SQLALAQAEI  120
MCLRIMQQDA HDDFITDLTE HTMQYPSPDA NDGQQLRSSM FLDDQEAFNL MD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-43141215112LOB family transfactor Ramosa2.1
5ly0_B5e-43141215112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019424969.12e-58PREDICTED: LOB domain-containing protein 4-like
RefseqXP_021634142.12e-58LOB domain-containing protein 4-like
RefseqXP_027911589.12e-58LOB domain-containing protein 4-like
SwissprotQ8LBW33e-52LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2C9UJM04e-57A0A2C9UJM0_MANES; Uncharacterized protein
TrEMBLA0A4D6M8Q95e-57A0A4D6M8Q9_VIGUN; Carbamoyl-phosphate synthase large subunit
TrEMBLA0A4P1QQH65e-57A0A4P1QQH6_LUPAN; Uncharacterized protein
STRINGcassava4.1_021609m7e-58(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-40LOB domain-containing protein 4
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]