PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9839150g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 180aa    MW: 19804.4 Da    PI: 5.2063
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9839150g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.15.4e-42151141100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+C ++Cvlapyfp+++ +kfa +h++FGasn++kll++lp e+r+da+ss+vyeA+ar+rdP yG++g+++++q+ql+ql+++l
  MA_9839150g0010  15 PCAACKILRRRCGEKCVLAPYFPSNDLHKFATAHRIFGASNIIKLLQELPAERRTDAVSSMVYEANARLRDPLYGCAGIVFQMQSQLSQLQSQL 108
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  MA_9839150g0010 109 ATAQAE 114
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.84114115IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-4115112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MASNVGGFRD HAPSPCAACK ILRRRCGEKC VLAPYFPSND LHKFATAHRI FGASNIIKLL  60
QELPAERRTD AVSSMVYEAN ARLRDPLYGC AGIVFQMQSQ LSQLQSQLAT AQAEILTMRL  120
QQANLLALIT GSADSGETTR PLSPSSSAIS QESNDQQTDL IYFEGEDPLQ LWDDSVWTQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-391411610112LOB family transfactor Ramosa2.1
5ly0_B6e-391411610112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0845570.0EF084557.1 Picea sitchensis clone WS0271_N08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019227600.14e-64PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR08e-58LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA9NTB01e-129A9NTB0_PICSI; Uncharacterized protein
STRINGGSMUA_Achr7P15500_0013e-62(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-50LOB domain-containing protein 1