PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_97259g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 282aa    MW: 31358.8 Da    PI: 8.7208
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_97259g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.21.4e-3675132259
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                    ++k ++cprC+s++tkfCy+nny+++qPr++C+ C+ryWt+GG+lrnvPvG+grrknk
  MA_97259g0020  75 PTKLVPCPRCESMDTKFCYFNNYNVNQPRHYCRRCQRYWTAGGSLRNVPVGAGRRKNK 132
                    67889****************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2864132IPR003851Zinc finger, Dof-type
PfamPF027012.9E-3078132IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.07179133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MPKFEGKSAK SLDSTFKLFG RTIAVKNPCD SSSNGIHVDG IPAEAANSVV SKASETHRDE  60
KQKQNEDSEK VGKKPTKLVP CPRCESMDTK FCYFNNYNVN QPRHYCRRCQ RYWTAGGSLR  120
NVPVGAGRRK NKPCFGIHHR QIMDDTESVW SDGQGQTSRG NSDKLVKVEP FYPEFDNFRE  180
GLNEAATPTE GNSKPQSQIQ SQFDDYSHPS TLNLPKEKVA KEVLFGSGNQ VGAMGWPGNS  240
THLAKEPGNF THLAKEPGNF THLAKELESA QKPSCSQGNY RD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC6886820.0KC688682.1 Pinus pinaster Dof8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLT2B8A90.0T2B8A9_PINPS; Dof8
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-37cycling DOF factor 1