PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_944867g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 326aa    MW: 35931.4 Da    PI: 6.8331
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_944867g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.14e-38129188261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k ++cprC+s++tkfCy+nny+++qPr+fCk+CrryWt+GG++rn+PvG+grrk+k+ 
  MA_944867g0010 129 PSKPVACPRCHSSETKFCYFNNYNVNQPRHFCKNCRRYWTAGGTMRNIPVGAGRRKSKHF 188
                     67899****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-25128186IPR003851Zinc finger, Dof-type
PfamPF027013.9E-31132187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.323133187IPR003851Zinc finger, Dof-type
PROSITE patternPS013610135171IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MCKSSLGQAC NVDCESETRN SVIKLFGTTI SVSVSDGKAD EFLQEDACKR GKADEFLQED  60
ACKRPAQPFK TENLGERKAK SLRTENILEK SVKSQSSCDG GEKSLKPLRF EEFTDGKSEK  120
ASERAPPKPS KPVACPRCHS SETKFCYFNN YNVNQPRHFC KNCRRYWTAG GTMRNIPVGA  180
GRRKSKHFTT FQLHSASKSL DLQEPEGRIE NFEEPVNETR IFSFNDEATS VSSVTGVAGI  240
DMKVPCLEEM DAAISDSFVN SLTVNGVSGT GFSNLMDPGL KIKAISTENS QWIPEIQQNS  300
NSALLADCCV LYGKPMIPNC TQQAAE
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1050260.0BT105026.1 Picea glauca clone GQ02817_M14 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLT2B8N30.0T2B8N3_PINPS; Dof4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.17e-35cycling DOF factor 3