PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_94287g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family GRAS
Protein Properties Length: 583aa    MW: 65228.5 Da    PI: 5.2598
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_94287g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS318.61.4e-972025782373
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsPilkfsh 95 
                    ++lLl+c  a++++d +laq++++ l+++as +gdp+qR++++f++AL ar ar    +++a ++        +++l++ +l  f++++P+++f++
  MA_94287g0010 202 EQLLLHCSSALENNDVTLAQQIMWVLNNIASAEGDPNQRVTSCFLRALIARAAR----MANA-HVG------DTKRLSVIELagFVDLTPWHRFGF 286
                    79****************************************************....2222.222......334555555556************ PP

           GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl......v 182
                       N aI eaveg + vHi+Df+i +++QWp+L+++L++Rpegpp +R+T+  +  ++    + ++ee+g rL++fA++ +vpfef+++       
  MA_94287g0010 287 SSSNGAIAEAVEGYSVVHILDFGIAHCMQWPTLIDSLSKRPEGPPYIRLTVSCARPPVpplLSMSYEELGTRLSNFARSRNVPFEFRAIppdpneE 382
                    **************************************************987766667899999************************9988654 PP

           GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.......erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                       +++le++ L++++gEal+Vn++++lh+++de+v+++        +rde+L++++s +P++v++v+++++++s+s++ r+ +a++y +  fd+l
  MA_94287g0010 383 FLVVDQLEPSILDLREGEALVVNCQFRLHYIPDETVDQQIscsssscQRDEFLRIIRSFEPTIVTLVDEDSNLTSTSLVSRLKSAFNYLWIPFDAL 478
                    4578999*************************9998877666667899************************************************ PP

           GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                    ++ lpr+s +r+ +E   +g +i+n++a eg +r+er e+++kW +r+++a F+++ +se++++++k++l +++  g+ +++e++ l+l+Wk++++
  MA_94287g0010 479 DTFLPRDSIQRQQYESD-VGYKIQNIIAFEGHQRIERLESKAKWTQRMRKACFQSICFSEDTVAEVKSMLDEHA-AGWGLKKEEDDLLLTWKGHNV 572
                    *****************.9*******************************************************.8999***************** PP

           GRAS 368 vsvSaW 373
                    v++++W
  MA_94287g0010 573 VFATVW 578
                    ****** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.451175560IPR005202Transcription factor GRAS
PfamPF035144.7E-95202578IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MKGALEIMGI NHQADFQLSR HAPVLFSDKR MKEESRQFSV HNDAAALSPP DCFEDTGGHI  60
GWILSESSEL GQPSSVGLTS VNCQESNIDV NSIKTRQQSL QFTDTSDRPD STGHVQYMVK  120
NSPKLKTIDS KLAFSPRLRS PSVATTQREW NAMTDLNANS SHHYEELSTA PADQDQSWPL  180
LGVSIARGLG NLGACHDASC MEQLLLHCSS ALENNDVTLA QQIMWVLNNI ASAEGDPNQR  240
VTSCFLRALI ARAARMANAH VGDTKRLSVI ELAGFVDLTP WHRFGFSSSN GAIAEAVEGY  300
SVVHILDFGI AHCMQWPTLI DSLSKRPEGP PYIRLTVSCA RPPVPPLLSM SYEELGTRLS  360
NFARSRNVPF EFRAIPPDPN EEFLVVDQLE PSILDLREGE ALVVNCQFRL HYIPDETVDQ  420
QISCSSSSCQ RDEFLRIIRS FEPTIVTLVD EDSNLTSTSL VSRLKSAFNY LWIPFDALDT  480
FLPRDSIQRQ QYESDVGYKI QNIIAFEGHQ RIERLESKAK WTQRMRKACF QSICFSEDTV  540
AEVKSMLDEH AAGWGLKKEE DDLLLTWKGH NVVFATVWVP SHL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-4919758183475Protein SHORT-ROOT
5b3h_B4e-5019758129421Protein SHORT-ROOT
5b3h_E4e-5019758129421Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0680560.0FJ068056.1 Pinus taeda isolate 8023 anonymous locus 0_2222_01 genomic sequence.
GenBankFJ0680580.0FJ068058.1 Pinus taeda isolate 8019 anonymous locus 0_2222_01 genomic sequence.
GenBankFJ0680600.0FJ068060.1 Pinus taeda isolate 8012 anonymous locus 0_2222_01 genomic sequence.
GenBankFJ0680620.0FJ068062.1 Pinus taeda isolate 8008 anonymous locus 0_2222_01 genomic sequence.
GenBankFJ0680640.0FJ068064.1 Pinus taeda isolate 8007 anonymous locus 0_2222_01 genomic sequence.
GenBankFJ0680690.0FJ068069.1 Pinus taeda isolate 8013 anonymous locus 0_2222_01 genomic sequence.
GenBankFJ0680700.0FJ068070.1 Pinus taeda isolate 8011 anonymous locus 0_2222_01 genomic sequence.
GenBankFJ0680710.0FJ068071.1 Pinus taeda isolate 8021 anonymous locus 0_2222_01 genomic sequence.
GenBankFJ0680730.0FJ068073.1 Pinus taeda isolate 8020 anonymous locus 0_2222_01 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279517.31e-179PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-138SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A438KQL41e-177A0A438KQL4_VITVI; Scarecrow-like protein 32
TrEMBLA5ANJ01e-177A5ANJ0_VITVI; Uncharacterized protein
STRINGVIT_07s0129g00340.t011e-178(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-136GRAS family protein