PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9412105g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 197aa    MW: 21934.6 Da    PI: 8.9555
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9412105g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.67.6e-42431421100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq ++l++el
  MA_9412105g0010  43 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLLEVPESQRADAANSLVYEANVRLRDPVYGCMGAISSLQQQAQSLQSEL 136
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  MA_9412105g0010 137 NSVRAE 142
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.41642143IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4143140IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MSRERENFEN FSRRASFKQL ADADRMGRRQ ILGPPGTLNT ITPCAACKLL RRRCAQECPF  60
SPYFSPHEPQ KFASVHKVFG ASNVSKMLLE VPESQRADAA NSLVYEANVR LRDPVYGCMG  120
AISSLQQQAQ SLQSELNSVR AEIMRYKFRS EAAAMHHQPP GQSSHQASMM PSSSAVYSQG  180
SASTDYTAMN DHSNYYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-45351463114LOB family transfactor Ramosa2.1
5ly0_B1e-45351463114LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1022330.0BT102233.1 Picea glauca clone GQ0171_H05 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018821727.13e-90PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T51e-74LBD15_ARATH; LOB domain-containing protein 15
SwissprotQ9AT613e-74LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A3S3NG725e-89A0A3S3NG72_9MAGN; LOB domain-containing protein 15
STRINGXP_007137607.14e-88(Phaseolus vulgaris)
STRINGcassava4.1_031813m3e-88(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-68LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]
  2. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]