PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_939289g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 338aa    MW: 37387.8 Da    PI: 7.9079
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_939289g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.34.6e-403998362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ++alkcprCds ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+s+
  MA_939289g0010 39 DQALKCPRCDSPNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKRSK 98
                    7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-283496IPR003851Zinc finger, Dof-type
PfamPF027013.5E-333996IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6654296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MMMQQESGAG ISGVSPTDDQ VMAQDEQQHR STVNSNVDDQ ALKCPRCDSP NTKFCYYNNY  60
NLTQPRHFCK TCRRYWTKGG ALRNVPIGGG CRKNKRSKQR PKDQNPLTPM DQEAASPTSM  120
NGLSLLHNLW ATQPTSSSNL LELPSSDRFN FAFAKLQNHS SFLGQPSNNN IISSNIPIMS  180
HVMKPSIKAN GVGDPSGGHM TTLFQTPAVQ TSPLTAPPPS SSSVDGTGSV SFGLQSLSNA  240
TDHWHWKMQQ QRLGMGLADQ GQNMDGNLFL PNVLNNDHRY STSNLQHQHV KGKPVVPSDL  300
LSQVYDNRPV SEWQTVAADN LLEPVTVETS YWHDMQMM
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-35DOF zinc finger protein 1