PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_934266g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Trihelix
Protein Properties Length: 498aa    MW: 57960.7 Da    PI: 8.117
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_934266g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix34.45.6e-11291335145
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergfer 45 
                     rW++ ev aLi++r++m++r++++  + +lWee+s++m +  + +
  MA_934266g0010 291 RWPRPEVYALIKLRSDMDQRFKESGPRVALWEEISSAMLDSLYDK 335
                     8*************************************7765554 PP

Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MHERHILSCY CNLCAVSLQR WGSTEVQRSA RKNLRMSINT TRKEKFENVY KYYKKTKDGR  60
INRQDGKSYR FCSEIEALYA GVSVKNSGID KDADIGACSD GNIRNQGVMK NPSSLLINNI  120
NQLQEETTFP RSTESIDNAR KNLSSDGTST EEDLGKSKSE MQINRKRRKR KQSLSSIKDL  180
LENMIKRWME RQESSQKKFL EAIEKRDQDR LIREEAWKLQ EMARLNRETE LRAQEHALQS  240
SREKAIIEYL EKLTSQNFKL DPRIIPMQST PNAQEDENNT ARGKIDLHSN RWPRPEVYAL  300
IKLRSDMDQR FKESGPRVAL WEEISSAMLD SLYDKGVLLS PNHPKYDNKL ENTSNSEALT  360
GIDGDDDDQE RGQEMKVNDQ DPELLAIVAA STQRTVQPES TSSERMEYLA QKMMKWNPTV  420
IQTMDDQAVS VNSRPSSEYL GRSNNDNNNK RFRMGRLVQE GLEPQQNQYR KFLDECRRRE  480
HEEQHLTDKE VGHHQQQQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164170RKRRKRK
2164171RKRRKRKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1122750.0BT112275.1 Picea glauca clone GQ03312_N09 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.26e-31Trihelix family protein