PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_927067g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 210aa    MW: 22966.8 Da    PI: 6.3411
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_927067g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.81.4e-36421403101
          DUF260   3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                     aa k  +r+C ++Cvlapyfp ++p+kfa vh +FGasn++++l+++ +e+r+da+ss+vyeA+ar+rdP+yG++gv+ +lqqq++ l+++la++
  MA_927067g0010  42 AAGKGSKRRCGDKCVLAPYFPPNDPQKFASVHTVFGASNIIRILQDVGTEHRDDAVSSMVYEARARLRDPIYGCAGVVCQLQQQVCDLQSQLATA 136
                     56677899**************************************************************************************9 PP

          DUF260  98 keel 101
                     ++++
  MA_927067g0010 137 QAQI 140
                     9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.28939140IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-3642137IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MASMTVLSPN IFLANPDLLG ARGDSPPTRG DGRSHHSKSF AAAGKGSKRR CGDKCVLAPY  60
FPPNDPQKFA SVHTVFGASN IIRILQDVGT EHRDDAVSSM VYEARARLRD PIYGCAGVVC  120
QLQQQVCDLQ SQLATAQAQI LNLHCQQENL LPFLTASISS SRKGGETDDY DYNEPLGSSW  180
TDSPASQVTY GEKDINFLLQ EMFMWSSYGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-354215613131LOB family transfactor Ramosa2.1
5ly0_B9e-354215613131LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1047710.0BT104771.1 Picea glauca clone GQ02814_K04 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019256526.11e-51PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-44LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1J6HW412e-50A0A1J6HW41_NICAT; Lob domain-containing protein 11
TrEMBLA0A2Z7BKX01e-50A0A2Z7BKX0_9LAMI; LOB domain-containing protein 11-like
STRINGXP_009611728.11e-50(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-38LOB domain-containing protein 1