PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_92489g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SBP
Protein Properties Length: 518aa    MW: 57054.7 Da    PI: 7.8561
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_92489g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.11.9e-41243319177
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    +CqvegC++ l++akeyh+rhkvCe+hskap+v+v g+eqrfCqqCsrfh++sefD++krsCrrrLa+hnerrrk++
  MA_92489g0010 243 RCQVEGCNVVLANAKEYHKRHKVCEMHSKAPKVIVLGIEQRFCQQCSRFHAISEFDDAKRSCRRRLAGHNERRRKNS 319
                    6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-34238305IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.411241318IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.32E-39242323IPR004333Transcription factor, SBP-box
PfamPF031101.7E-32244317IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MDSNSHGGSS SSSHDHCWPS KMQDWHLRSP WDWEGCTGLY SGGDRYEKLP MAEWVCSEEG  60
YNIGKELFRG TSMVHESSSL SEPLMASGNY NEVITDRSFS GNHKAQFPLE VKIHPSSLAE  120
GSVKSEGNGL FKGWLVEGVT NAGNFLGGSE YSHSGQRNMV VVGLGGRNDN YHSGNEGPMR  180
ENINVIKDVQ GDSLTCLKLG KRQYFGDGAN PAKVIHPVSG NTTGDCVYKK PRALPASTAQ  240
PPRCQVEGCN VVLANAKEYH KRHKVCEMHS KAPKVIVLGI EQRFCQQCSR FHAISEFDDA  300
KRSCRRRLAG HNERRRKNSL DSLANSGSQE EKRLIGVLGE KFPMGRYALP YLPSPGRALS  360
LLSSQQSWMN SGVCSLPGDL SSRSSAALRE LIAENRAQSV SRYSDGQYDH REGRSVRMLQ  420
PPIQEQQAQS QEEMGNCRFM PGLRSLENNG KVEYVGDEVK KHGGVIGSHA VVVRPTLDLM  480
QHSNSLFALQ SGRNGSSSSS SSEEECEIWK TFEGTHIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-302443171184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1192070.0BT119207.1 Picea glauca clone GQ04102_L05 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9QX430.0A0A0C9QX43_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_2011_1782 transcribed RNA sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.18e-38squamosa promoter binding protein-like 3