PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_9135269g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 100aa    MW: 10832 Da    PI: 3.6315
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_9135269g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26037.75.9e-122514998
           DUF260 49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98
                     lp e+  +a++s++yeA ar++dP  G++g+i++lq q++ l++++ +++
  MA_9135269g0010  2 LPSEQGLEAINSMAYEASARLEDPAFGCTGIIQQLQLQISDLESQIIVTQ 51
                     56788889**********************************99987776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.948154IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-10251IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
DLPSEQGLEA INSMAYEASA RLEDPAFGCT GIIQQLQLQI SDLESQIIVT QAVIQKIRSQ  60
QAQLVASIPG FSNKFNPTIS TSVNDADEEG EDLFNSSLMD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1165251e-116BT116525.1 Picea glauca clone GQ03801_F09 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022743269.11e-15LOB domain-containing protein 1-like
TrEMBLA9P1U38e-39A9P1U3_PICSI; Uncharacterized protein
STRINGXP_008783779.17e-15(Phoenix dactylifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-08LOB domain-containing protein 1