PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_902082g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 168aa    MW: 18836.2 Da    PI: 4.8088
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_902082g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.62.7e-40101091100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCkv+++kC+++Cvlapyfp+++p kf  vh lFG+ +v+kll++lp e+r+da+sslvyeA+ar+ dPv+G+vgvi++lq++le+++ +la
  MA_902082g0010  10 ACAACKVQKKKCSEKCVLAPYFPQNDPDKFLLVHGLFGNGHVVKLLQDLPAEQRSDAVSSLVYEARARVADPVHGCVGVINDLQKKLEEVHLQLA 104
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     +++e+
  MA_902082g0010 105 STQEK 109
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.8789110IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3810107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MSQVSKAEPA CAACKVQKKK CSEKCVLAPY FPQNDPDKFL LVHGLFGNGH VVKLLQDLPA  60
EQRSDAVSSL VYEARARVAD PVHGCVGVIN DLQKKLEEVH LQLASTQEKL DNISMQHSNM  120
LITLINTGYH QVWDPNFYNS SPQESQDTQY TNSSVLDDEV DNLDFWET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-321111012111LOB family transfactor Ramosa2.1
5ly0_B6e-321111012111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LQI94e-62B8LQI9_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-37LOB domain-containing protein 1