PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_88711g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 216aa    MW: 23301.2 Da    PI: 5.5706
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_88711g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.41.6e-45121111100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC++dCv+apyfp e+p+kfanvhk+FGasnv+k+l++l +++reda++sl+yeAear++dPvyG+vg i+ lq+q++ql++ela+
  MA_88711g0010  12 PCAACKFLRRKCTSDCVFAPYFPPEEPQKFANVHKIFGASNVTKILNDLAPHQREDAVNSLAYEAEARLQDPVYGCVGAISVLQRQVQQLQKELAA 107
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++ 
  MA_88711g0010 108 AHAD 111
                    9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.74911112IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4412109IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:1.20.58.607.4E-467177No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MTEMASISSN SPCAACKFLR RKCTSDCVFA PYFPPEEPQK FANVHKIFGA SNVTKILNDL  60
APHQREDAVN SLAYEAEARL QDPVYGCVGA ISVLQRQVQQ LQKELAAAHA DLLQYTSAVE  120
PFLIPHSPGS TLPSYSELQM IHAAAREQQQ QNLVEFPNSI EELQLSREQL LELAMRSGGS  180
YEAGLAALGM TNHAYALYPS PRPGGGGGSA SSGGSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-6291158114LOB family transfactor Ramosa2.1
5ly0_B2e-6291158114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024403438.15e-70LOB domain-containing protein 6-like
SwissprotQ8L8Q32e-64LBD25_ARATH; LOB domain-containing protein 25
TrEMBLH9X0F14e-79H9X0F1_PINTA; Uncharacterized protein (Fragment)
STRINGPP1S170_78V6.12e-69(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-66LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]