PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_85817g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 199aa    MW: 22309.3 Da    PI: 6.7846
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_85817g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.82.7e-41491491101
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck++r+kC+++Cvlapyfp+++p+kf  vhk+FG+ +v+kll++lp e+r da+ss+vyeA  r rdPv+G++gvi++lq+++++l+++la+
  MA_85817g0020  49 PCAGCKIQRKKCSQNCVLAPYFPQDKPHKFLLVHKVFGNGHVVKLLQDLPAEQRGDAVSSMVYEASQRFRDPVHGCAGVINDLQNKVAELQSQLAS 144
                    7*********************************************************************************************** PP

         DUF260  97 lkeel 101
                    ++++l
  MA_85817g0020 145 TQTQL 149
                    99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.58648149IPR004883Lateral organ boundaries, LOB
PfamPF031958.0E-4049146IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MLPRRASLFF HLSIPSFTFE NTLPVPTRSN GKMSDMSAKS KPETWSTSPC AGCKIQRKKC  60
SQNCVLAPYF PQDKPHKFLL VHKVFGNGHV VKLLQDLPAE QRGDAVSSMV YEASQRFRDP  120
VHGCAGVIND LQNKVAELQS QLASTQTQLA NISMHHANLL TIFNEGSGPH FYNGSLLENE  180
DTHTLDDDEP MELWEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-35461498111LOB family transfactor Ramosa2.1
5ly0_B6e-35461498111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6781420.0EF678142.1 Picea sitchensis clone WS02823_H17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588230.12e-51PREDICTED: LOB domain-containing protein 1-like
RefseqXP_012449770.14e-51PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016671354.14e-51PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-48LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB8LQI91e-121B8LQI9_PICSI; Uncharacterized protein
STRINGAquca_027_00112.12e-50(Aquilegia coerulea)
STRINGGorai.010G203800.12e-50(Gossypium raimondii)
STRINGXP_009588230.19e-51(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-44LOB domain-containing protein 1