PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_85817g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 164aa    MW: 18392.8 Da    PI: 5.9161
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_85817g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.84.9e-40141131100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck++r+kC+++Cvlapyfp+++p+kf  vh+lFG+ +v+k l++lpee+r da++s+vyeA  r rdPv+G+vgvi++lq+++++l++++a+
  MA_85817g0010  14 PCASCKIQRKKCSQSCVLAPYFPQDNPEKFLLVHRLFGNGHVIKSLQELPEEQRGDAVNSMVYEASQRFRDPVHGSVGVINDLQNKVAELQSQMAS 109
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  MA_85817g0010 110 TQTE 113
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.04813114IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3814111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MSANTKPEMR STSPCASCKI QRKKCSQSCV LAPYFPQDNP EKFLLVHRLF GNGHVIKSLQ  60
ELPEEQRGDA VNSMVYEASQ RFRDPVHGSV GVINDLQNKV AELQSQMAST QTELANISMR  120
HANLLTLLNG GSDPHCYNGL LLQSEDTHVL DDVDPMELWE PLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-33111148111LOB family transfactor Ramosa2.1
5ly0_B1e-33111148111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6776340.0EF677634.1 Picea sitchensis clone WS02772_C10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461085.11e-49PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-48LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB8LP641e-117B8LP64_PICSI; Uncharacterized protein
STRINGGorai.012G094200.15e-49(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-51LOB domain-containing protein 1