PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_84752g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 237aa    MW: 26690.7 Da    PI: 9.2728
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_84752g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.12e-40831821100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++C++apyf   +p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA+ar+rdPvyG++g+i +lq+q + l++el++
  MA_84752g0010  83 PCAACKLLRRRCAQECPFAPYFSPLEPQKFASVHKVFGASNVSKMLMEVPENQRADAANSLVYEANARLRDPVYGSTGTIYSLQRQAQVLRVELNA 178
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  MA_84752g0010 179 VRTE 182
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.19982183IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-4083180IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGNRIARFKP VAINAPPRFC FDTIVSNMSI FENSSPLFSR IAHLQVLPLI SDKDRKIIEQ  60
PDICEMTRRP TLGSPAALNT ITPCAACKLL RRRCAQECPF APYFSPLEPQ KFASVHKVFG  120
ASNVSKMLME VPENQRADAA NSLVYEANAR LRDPVYGSTG TIYSLQRQAQ VLRVELNAVR  180
TEIMRYKCRD PILQPPMLGV YNVNSDDCKV NNPTTSTVNA DDHTGKQRYY SIINHNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-44741902118LOB family transfactor Ramosa2.1
5ly0_B3e-44741902118LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448054.11e-70PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T52e-60LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0D2QQ342e-69A0A0D2QQ34_GOSRA; Uncharacterized protein
STRINGGorai.009G295000.11e-69(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.18e-63LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]