PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_83624g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 326aa    MW: 35689.6 Da    PI: 5.1306
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_83624g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof104.75.4e-3389140354
         zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGgg 54 
                    +++lkcprCdstntkfCyynnysl+qPr+fCk+CrryWtkGG+lr vP   g
  MA_83624g0010  89 QEILKCPRCDSTNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGSLRSVPRSNG 140
                    6789********************************************7666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.9E-2990140IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.88192146IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-2292140IPR003851Zinc finger, Dof-type
PROSITE patternPS01361094130IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
LRIPLDLGCL FAPETSELRA DLLVAFISIL SQEDGTFCLK ASSPVDVLSP AAMMKDQEEM  60
GVLEGTGDMM DSYPPRQLLD RRLKPQGDQE ILKCPRCDST NTKFCYYNNY SLTQPRHFCK  120
TCRRYWTKGG SLRSVPRSNG EACSSATGSD QLSPSLGGVS NDCKYYNGDG EELIGINYVN  180
SLRQVDHEAA FAGCSINSGV YGIQANDHQS SQSFQPYHLP TALQSLQGSL IQAPNGFNQA  240
ANRGDLGLVQ QQAAGAVSYD REAYHPYINM SLDHSDGHSR APQQHKSNNI IENPPQGLVY  300
EGGYWNGGVW PDLSAYGLSN INPNSM
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0828400.0EF082840.1 Picea sitchensis clone WS0298_N22 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9NNI10.0A9NNI1_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.17e-30TARGET OF MONOPTEROS 6