PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_79692g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 164aa    MW: 18482.8 Da    PI: 4.6663
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_79692g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26094.89.2e-30221175100
         DUF260   5 CkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                    Ck+ +++C ++C++   f++++ +kf ++h++FGa nv+kl+++lp ++r da++s+vyeA ar++dPv G+vg i+klq q++ l++++ ++++ 
  MA_79692g0010  22 CKMEQKDCLENCTILYSFASNDLHKFSILHQVFGACNVIKLVQDLPSDQRVDAINSMVYEASARLQDPVFGCVGKIQKLQLQISDLQSQITATQST 117
                    *****************************************************************************************9998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.12717118IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-2821115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MMSNAKEKPR TQSSSAAFHD HCKMEQKDCL ENCTILYSFA SNDLHKFSIL HQVFGACNVI  60
KLVQDLPSDQ RVDAINSMVY EASARLQDPV FGCVGKIQKL QLQISDLQSQ ITATQSTIQK  120
IRSQRTQLLD CIPGFKNRDN PTICTSLNED DEEDQDLLDS DLID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-26111204113LOB family transfactor Ramosa2.1
5ly0_B1e-26111204113LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1102430.0BT110243.1 Picea glauca clone GQ03218_K02 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9P1U34e-65A9P1U3_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-27LOB domain-containing protein 1