PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_79619g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Trihelix
Protein Properties Length: 712aa    MW: 80177.5 Da    PI: 7.0854
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_79619g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.58.5e-29137221187
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                    rW+++e+laL+++r+ +++++r+++ k+plWe vs+k+ e g+ rs+k+Ckek+en++k+ykk+k+g+++r++++s  +++f++lea
  MA_79619g0010 137 RWPREETLALLRIRSGLDSNFRDSNIKGPLWENVSRKLGELGYFRSAKKCKEKFENISKYYKKTKDGRIGRQDGKS--YRFFSELEA 221
                    8*********************************************************************866665..******985 PP

2trihelix104.29.7e-33418502186
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                    rW+k ev+aLi++r++m++++++   k+plWee+s+ m+  gf+rs+k+Ckekwen+nk+++k+k+++kkr +++ +tcpyfdql+
  MA_79619g0010 418 RWPKPEVQALIRLRSNMDTKFQEPGFKGPLWEEISSGMACLGFHRSAKRCKEKWENINKYFRKTKDNMKKR-PQNAKTCPYFDQLN 502
                    8*********************************************************************8.99999*******96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.081134196IPR001005SANT/Myb domain
PfamPF138374.2E-19136222No hitNo description
CDDcd122031.27E-25136201No hitNo description
PROSITE profilePS500906.388136194IPR017877Myb-like domain
PROSITE profilePS500908.037411475IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.6E-5411474IPR009057Homeodomain-like
SMARTSM007174.6E-5415477IPR001005SANT/Myb domain
CDDcd122032.58E-29417482No hitNo description
PfamPF138371.6E-21417502No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MQSGHGQYGG LPGIQQFVVE SCSSPHGLFA ALSQEQINHN TNHPLQINQA QAHQAIQQAG  60
FQNQKVLQQH QLGLQAAESS DAPPRSRDLN SNKAYGSLRE AAAGSHVQGR EQVPPQTLTD  120
DDGAGEEGER GGGGVNRWPR EETLALLRIR SGLDSNFRDS NIKGPLWENV SRKLGELGYF  180
RSAKKCKEKF ENISKYYKKT KDGRIGRQDG KSYRFFSELE ALYSHSHGGS RSSIANANRT  240
TGQEVTGIEG PEKTSNAATL HLSSDNTSED DHYNNNCQNP MPSETHEQVN RKKRKRKHLA  300
SITAFFESLV KQVMGHQEEL HRKFLEAIER REQERLNREE AWKRQEMARL NRETELRAQE  360
HALASTREAA IVAFLQKITG QNLNLPTSAA PPLAPTETQQ EQEKLADDAV MPDLNSKRWP  420
KPEVQALIRL RSNMDTKFQE PGFKGPLWEE ISSGMACLGF HRSAKRCKEK WENINKYFRK  480
TKDNMKKRPQ NAKTCPYFDQ LNLLYSNNPR SSKMEGHSSD DQADPDHDNN NDNNNNGEDD  540
EHAQIRPSDS ELLAAMIHGD QAGGTSLAKN NAATTTVHDH FFQDGHPVDQ VQKRFKTKQH  600
LPAGIQASNP LVIISEGGSK LNAFEDTFSG NIKKGATMDS LVKEMLEMQQ QKFLDAFDRR  660
EHEQEQQQSM SSEERQQRHH HPEETTQDDR SQSALMALVH KLTVNATDYA TG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290295RKKRKR
2290296RKKRKRK
3291296KKRKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1166790.0BT116679.1 Picea glauca clone GQ03804_H24 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ391171e-101TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0C9S5C50.0A0A0C9S5C5_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_12946_2942 transcribed RNA sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-92Trihelix family protein