PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_79519g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Trihelix
Protein Properties Length: 753aa    MW: 84713.4 Da    PI: 6.5741
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_79519g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix963.6e-30159243187
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                    rW+++e+laL+++r+em+ ++r+++lk+plWe+vs++++e g++r pk+Ckek+en++k+yk+ keg+ +r  ++ +++++f+qlea
  MA_79519g0010 159 RWPREETLALLKIRSEMDANFRDASLKGPLWEHVSRRLEELGYHRDPKKCKEKFENIHKYYKRSKEGRVGR--QDGKNYRFFSQLEA 243
                    8********************************************************************97..66678*******85 PP

2trihelix1086.2e-34466551187
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                    rW+k evlaLi++r+ m+ r++++  k+plWe++s++m++ g++rs+k+Ckekwen+nk+ykk+ke++kkr +e+s+tcpyf ql+a
  MA_79519g0010 466 RWPKPEVLALIKVRSGMGPRFQETGPKGPLWEDISAQMASLGYNRSAKRCKEKWENINKYYKKTKESNKKR-AENSKTCPYFYQLDA 551
                    8*********************************************************************8.78889*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0012156218IPR001005SANT/Myb domain
CDDcd122037.25E-26158223No hitNo description
PROSITE profilePS500906.829158216IPR017877Myb-like domain
PfamPF138371.1E-20158244No hitNo description
SMARTSM007174.3E-5463525IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-4464529IPR009057Homeodomain-like
CDDcd122035.71E-31465530No hitNo description
PfamPF138373.9E-22465552No hitNo description
PROSITE profilePS500907.538466523IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MQASGVQYGM ADVSQFMVGR GPSSRVQNIF QVSSSSDQQQ YSSHQQQQHV SKNHQPQQQQ  60
QQLRQQEHLK DQMVAAAEKV GEGSAYNSPR KQVEQSPTSA QQVQAGNIST DKVSSSGVAA  120
GGDDDVFGRR IAAGGDDDVF GVGEDCERLA GGGGSAGNRW PREETLALLK IRSEMDANFR  180
DASLKGPLWE HVSRRLEELG YHRDPKKCKE KFENIHKYYK RSKEGRVGRQ DGKNYRFFSQ  240
LEALYSNNNS KPPYNSNKTM NDASTISNGG GRVQAHEDPM STRQDEDNNN LGGNFMVGTT  300
SAGNTDLNSS EGISFSSDSS EDYDEPRDSN NKKRKRRGTK KLMAFFESLM KQMMEKQEKM  360
QQKFLETIEK KEQDRMMREE AWKRQEMARL NRDQELRSQE RSVAASRDLA LVSFLQKFTG  420
QTLQLDTQLM DSSQIHNQGD QEQEQEQDLH DEQYKDLNCT DPNSKRWPKP EVLALIKVRS  480
GMGPRFQETG PKGPLWEDIS AQMASLGYNR SAKRCKEKWE NINKYYKKTK ESNKKRAENS  540
KTCPYFYQLD ALYRRGMLSN PNKVIQMHDE DIRPDDEDHQ DELLEQVSGS NIREDSGQGQ  600
GADGDGDGEI LPVRPPPRPH SDSSAPPQTP TSNAPATLFS TPESRNADNG SLPKDSLKRE  660
GLLMKEILGH MQSTPTPQHD PQSVLENGSS GQNNIKKIGL VHSVMDNLQE QGKQKQADLH  720
YSASTRDTNS FMEMVQKLTA ANTLEFNLSA SSQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1325334PRDSNNKKRK
2331336KKRKRR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specific DNA sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0708970.0BT070897.1 Picea sitchensis clone WS02758_I21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ391171e-113TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLA0A0D6QXM91e-155A0A0D6QXM9_ARACU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.18e-48Trihelix family protein