PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_78381g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 247aa    MW: 27225.1 Da    PI: 8.3245
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_78381g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox406.8e-131301602656
                    -HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox  26 saeereeLAkklgLterqVkvWFqNrRakek 56 
                      ++++ LAk+l+L  rqV vWFqNrRa+ k
  MA_78381g0010 130 MSKQKQALAKRLNLRPRQVEVWFQNRRARTK 160
                    57899************************98 PP

2HD-ZIP_I/II92.74.1e-301311952691
    HD-ZIP_I/II  26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+ke +eLr +l
  MA_78381g0010 131 SKQKQALAKRLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTDENRRLQKELQELR-AL 195
                    69************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.2E-96113IPR006712HD-ZIP protein, N-terminal
SMARTSM003890.0011105166IPR001356Homeobox domain
PROSITE profilePS5007112.617128162IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-11128160IPR009057Homeodomain-like
PfamPF000462.8E-10130160IPR001356Homeobox domain
SuperFamilySSF466892.65E-10131170IPR009057Homeodomain-like
CDDcd000861.18E-9131163No hitNo description
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
CDDcd146860.00131153194No hitNo description
SMARTSM003404.5E-26162205IPR003106Leucine zipper, homeobox-associated
PfamPF021835.9E-11162196IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGMDMEDCNT GLGLGMSIGL GIGLLREDLH SHRHHVNGPP VQLDLLPLAP GLPSRDLPWG  60
KTSPGTDGER SAGESKATVP RRIDVNKLPA SCYYNEDAGT INVSSPNSAL SSFHVDSGGA  120
INAESSCYAM SKQKQALAKR LNLRPRQVEV WFQNRRARTK LKQTEVDCEF LKRCCESLTD  180
ENRRLQKELQ ELRALKLASP LYMQMPAATL TMCPSCERVV PAENSRPPPF TLAKPQFYPY  240
THSSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154162RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0818140.0EF081814.1 Picea sitchensis clone WS0294_F04 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849539.12e-63homeobox-leucine zipper protein HOX11
TrEMBLA9NKN41e-164A9NKN4_PICSI; Uncharacterized protein
STRINGERN111207e-63(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-57HD-ZIP family protein