PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_77200g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 185aa    MW: 20615.6 Da    PI: 6.0675
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_77200g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.81.6e-42391381100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+C+++Cvlapyfp+++++kfa +h++FGasn++k+l++lp e+r da+ss+vyeA ar+rdPvyG++g+i++lqq++++l+ e a 
  MA_77200g0010  39 PCAACKLLRRRCTESCVLAPYFPQNDAQKFADAHRVFGASNIIKMLEDLPLEKRADAVSSMVYEASARLRDPVYGCAGTIWQLQQHVSKLQLEKAI 134
                    7******************************************************************************************99999 PP

         DUF260  97 lkee 100
                    l++e
  MA_77200g0010 135 LQAE 138
                    8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.39738139IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-4239136IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MPLCDLLIDA ICHDANGLLF GNCILQMSEF RGGRQTTSPC AACKLLRRRC TESCVLAPYF  60
PQNDAQKFAD AHRVFGASNI IKMLEDLPLE KRADAVSSMV YEASARLRDP VYGCAGTIWQ  120
LQQHVSKLQL EKAILQAELL HMHMQQANIS SYIRENLHIV EGGDQSISEP FSHTLHDSCD  180
ELPTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-393814010112LOB family transfactor Ramosa2.1
5ly0_B5e-393814010112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1237530.0BT123753.1 Picea sitchensis clone WS04716_N08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251265.13e-53LOB domain-containing protein 1
SwissprotQ9SK083e-49LBD11_ARATH; LOB domain-containing protein 11
TrEMBLD5ABY41e-110D5ABY4_PICSI; Uncharacterized protein
STRINGSolyc11g072470.1.11e-52(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-51LOB domain-containing protein 11