PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_7537g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 419aa    MW: 45988.2 Da    PI: 6.4984
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_7537g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.4e-3952110462
        zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    alkcprCds+ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+++
  MA_7537g0010  52 VALKCPRCDSSNTKFCYYNNYSLSQPRYFCKTCRRYWTNGGSLRNVPVGGGCRKNKRAK 110
                   5789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2839108IPR003851Zinc finger, Dof-type
PfamPF027014.8E-3353108IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.47854108IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MVLRSVPNCH DSDIWSQSDM QDSVFKPSEE MLRPCSRPGL MDRRQKPNAD QVALKCPRCD  60
SSNTKFCYYN NYSLSQPRYF CKTCRRYWTN GGSLRNVPVG GGCRKNKRAK RTGDQPVNFS  120
GQNMESTTST SATNNNNEFN RCSSNLDQTS LPTLPSVYFN LLNEGTDGLG VAYSGRSLHQ  180
QQALRVADQS LLRGNCNSSA GILEISATSS EPTSLLPPLP NLPNLTSLLK SANLITGLES  240
PRISCSRADQ GASMAVRGDL RSIFEAQVAA TTSTAAILQV SDGFNDTFGL AVPGDRLNSD  300
QIHDNDIQWQ MQQQVDQQKL VIPVDNHGTE QVMLPYVHEN NGADELGHHH DLKLRQLFMT  360
SIPSSLGKVY DENRPGACNW QLPALSEGLL DTPGNNIGYW NGGGLPDLSS YASYTNSLI
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-35TARGET OF MONOPTEROS 6