PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_74014g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 391aa    MW: 43312.5 Da    PI: 6.1645
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_74014g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-393999262
         zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                   +e+ lkcprCds+ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rknk+++
  MA_74014g0010 39 TEQPLKCPRCDSANTKFCYYNNYNLSQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKRAK 99
                   67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-274197IPR003851Zinc finger, Dof-type
PfamPF027011.9E-334197IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.8794397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MDSADWTQSF LQNSALKLSE DLMSCPRPPM LERRIKPQTE QPLKCPRCDS ANTKFCYYNN  60
YNLSQPRHFC KTCRRYWTKG GALRNVPVGG GCRKNKRAKR AIDHPVSAQN EASTSAAPGN  120
EVPDRSAFEP TLPPSSKSIY YGGENMNLTG LPFTRIQQDR AALAHCNSSS FLGMSCGTQS  180
ASLEPHLSAL NTFNSFKSNN PGLDFSSLST DQNSLFESSQ PQLSRAMASA LFAMPMVPGL  240
DDPADFHWKL QQQQQQKLSF PFGDGQIDNG PGNERHDFLT YEDSSKNDLK PEVVTKLPSS  300
SVKVEEDQNA LASDWQVPAS EPLFAGDSNS YWNGGAWPDI TTYGLSDSCR YFFFYGVFGM  360
AVAAELSSIC HLCRFIGDGA VPFLLYYLLL E
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC6886770.0KC688677.1 Pinus pinaster Dof2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLT2B8A70.0T2B8A7_PINPS; Dof2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-34TARGET OF MONOPTEROS 6