PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_734074g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 81aa    MW: 8910.91 Da    PI: 3.9424
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_734074g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26032.82e-101396199
          DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                    +vyeA ar++dP  G+vg+i++lq q++ l++ + ++++
  MA_734074g0010  1 MVYEASARLQDPALGCVGIIQQLQLQISDLQSRITATQA 39
                    69******************************9998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031955.7E-8138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508918.89141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MVYEASARLQ DPALGCVGII QQLQLQISDL QSRITATQAT IQKIRSQQAQ LVASIPGFNN  60
KFNPTMSTSL NDSDDEDEDL E
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0876171e-133EF087617.1 Picea sitchensis clone WS02730_N15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9P1U35e-50A9P1U3_PICSI; Uncharacterized protein