PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_72133g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YA
Protein Properties Length: 369aa    MW: 39994.4 Da    PI: 7.7663
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_72133g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.44.8e-33187243158
      CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                    +ep+YVNaKQy++Il+RRq Rak+e+e+kl +k+rkpylheSRh hA++R+Rg+gGrF
  MA_72133g0010 187 EEPVYVNAKQYHGILRRRQLRAKAESENKL-IKTRKPYLHESRHLHAMKRARGCGGRF 243
                    69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-38185246IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.13186246IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.3E-28188243IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-23189211IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860191211IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.1E-23220243IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MQGVECKEHR ESDGQPNLSS AVPGMPWWNG FGTQFPQSAW CAPVKSLFMD HPSRVPGAIK  60
QVASQSQQLE QPSTQVAVQS QSEGEAVLAG TTRMQSMSNQ SGYSGANGEK QHQHQSTKSI  120
IASAPTEYLV PHAQLEFNHS IACAAYPYAE PYFGGILAAY PAQAMIHPNM LGVQQARMPL  180
PLDMTEEEPV YVNAKQYHGI LRRRQLRAKA ESENKLIKTR KPYLHESRHL HAMKRARGCG  240
GRFLNTKKLE DLKANMDNGK TSEGHPAQAG SSSGSEVLQS ENGNGNSTQE VHGACGLSGS  300
EVTSIAQSSE NGTAYQYAHT NGTYLNHYQH QHFHISAFHP LSSGGEEGSS AKSGSILSGG  360
SQQRVVVIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-20187247262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0705820.0BT070582.1 Picea sitchensis clone WS02737_K13 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLC0PQJ90.0C0PQJ9_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6801672
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.21e-44nuclear factor Y, subunit A7