PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_66501g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 129aa    MW: 14688 Da    PI: 8.6963
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_66501g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.52.1e-38211201100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+ rr+C+++C++apyfp+++++++a+vhk+FGa+nv+k++++lp ++r+da++++v eA+ar++dPvyG++g++ +lq +++qlk+++a+
  MA_66501g0010  21 PCAACKMRRRRCTEKCPFAPYFPQSRAESYAAVHKIFGANNVMKMVQDLPVDKRSDAIKCMVIEANARLKDPVYGCTGIVCQLQLRVSQLKSQIAK 116
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++ 
  MA_66501g0010 117 TQSD 120
                    9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.23620121IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3821118IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MQSHNRDEEE EGERHNVLIS PCAACKMRRR RCTEKCPFAP YFPQSRAESY AAVHKIFGAN  60
NVMKMVQDLP VDKRSDAIKC MVIEANARLK DPVYGCTGIV CQLQLRVSQL KSQIAKTQSD  120
IQSIVRIFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-312012110111LOB family transfactor Ramosa2.1
5ly0_B1e-312012110111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008783779.16e-43LOB domain-containing protein 1-like
SwissprotQ8LBW36e-39LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A022RH941e-41A0A022RH94_ERYGU; Uncharacterized protein
STRINGMigut.F02029.1.p2e-42(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-41LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]