PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_61242g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 223aa    MW: 23901 Da    PI: 8.2671
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_61242g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.98.2e-4424122199
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC++dCv+apyfp eqp+kfa vhk+FGasn++k+l++l +++reda+ssl+yeAear++dPvyG+vg i+ lq q++ql+ ela+
  MA_61242g0010  24 PCAACKFLRRKCTADCVFAPYFPPEQPHKFASVHKIFGASNISKVLNDLLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQGQVQQLQRELAE 119
                    7*********************************************************************************************99 PP

         DUF260  97 lke 99 
                    +++
  MA_61242g0010 120 ARA 122
                    875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.19123124IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-4324121IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MASSSSCYSS ASGSGSSSSS GSSPCAACKF LRRKCTADCV FAPYFPPEQP HKFASVHKIF  60
GASNISKVLN DLLPHQREDA VSSLAYEAEA RVKDPVYGCV GAISVLQGQV QQLQRELAEA  120
RAGLARYTSM EMGMQGVLGV PVHQSSHRLL QLRRERVQEL ARLQRSGGPC GEVLGVAAAD  180
IFNFTPSSSS LPTNPPPACT APHTGCCEFM RREAFYDKDK GSH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-57141331120LOB family transfactor Ramosa2.1
5ly0_B3e-57141331120LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1193591e-154BT119359.1 Picea glauca clone GQ04104_K10 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006344452.12e-60PREDICTED: LOB domain-containing protein 25-like
RefseqXP_028778573.11e-60LOB domain-containing protein 25-like
SwissprotQ9FML44e-59LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLM1BJE06e-59M1BJE0_SOLTU; Uncharacterized protein
STRINGPavir.J38993.1.p1e-59(Panicum virgatum)
STRINGPGSC0003DMT4000466449e-60(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.43e-49LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]