PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_608139g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NF-YA
Protein Properties Length: 194aa    MW: 21146.5 Da    PI: 7.3235
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_608139g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA107.21.3e-331066158
       CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                    dep+YVNaKQy++Il+RRq+Rak+e e+kl +k rkpylheSRh hA+rR+Rg+gGrF
  MA_608139g0010 10 DEPVYVNAKQYHGILRRRQSRAKAELENKL-IKVRKPYLHESRHLHAMRRARGCGGRF 66
                    79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.2E-37869IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.68969IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.8E-281166IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-241234IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068601434IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.4E-244366IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MPLPSDVIED EPVYVNAKQY HGILRRRQSR AKAELENKLI KVRKPYLHES RHLHAMRRAR  60
GCGGRFLNTK LLETTKVNAD SGKLTEGQHA WAVSSSSTEA LQSENGNMNS SEVHGNSGLS  120
GSEVTSMSES CPDGTSYSYT QGNGGYLYHH ASSHFHLLGF SPLSDGSGEV ESGQGMGYGI  180
KWIAAESCCD PMKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-211085276NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1049130.0BT104913.1 Picea glauca clone GQ02816_I15 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010247679.13e-52PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1
RefseqXP_010247683.12e-52PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
RefseqXP_010247690.18e-53PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X3
SwissprotQ84JP12e-35NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
SwissprotQ9LNP66e-35NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLA0A0D6QWS46e-88A0A0D6QWS4_ARACU; Uncharacterized protein
STRINGXP_010247679.11e-51(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6801672
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.17e-38nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  3. Djami-Tchatchou AT,Ntushelo K
    Expression Profile of Stress-responsive Arabidopsis thaliana miRNAs and their Target Genes in Response to Inoculation with Pectobacterium carotovorum subsp. carotovorum.
    Pak. J. Biol. Sci., 2017. 20(3): p. 147-153
    [PMID:29023006]