PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_57689g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 371aa    MW: 41593.6 Da    PI: 5.702
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_57689g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.32.3e-17233287256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  MA_57689g0010 233 RKKLRLSKEQSALLEESFKEHNTLNPKQKLALAKQLSLRPRQVEVWFQNRRARTK 287
                    778899***********************************************98 PP

2HD-ZIP_I/II1278.4e-41233322191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rlskeq++lLEesF+e+++L+p++K +la++L l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  MA_57689g0010 233 RKKLRLSKEQSALLEESFKEHNTLNPKQKLALAKQLSLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTEENRRLQKEVQELR-AL 322
                    69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.3E-794189IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.63E-17223290IPR009057Homeodomain-like
PROSITE profilePS5007117.313229289IPR001356Homeobox domain
SMARTSM003894.9E-15231293IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-16233287IPR009057Homeodomain-like
CDDcd000862.97E-15233290No hitNo description
PfamPF000469.7E-15233287IPR001356Homeobox domain
PROSITE patternPS000270264287IPR017970Homeobox, conserved site
CDDcd146860.00192282321No hitNo description
PfamPF021838.2E-12289323IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.9E-27289332IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MPDFESFDES FITPCLLSNL STIPGFRSWY VPGSSYPLDL ALKFHTTEKL QVVGFFLARF  60
EIIGPFCDFS SAPMAGFQYF VKTMPRSAED YGAGLRLGMG RVEEEKEEEE EGCWQQQKRN  120
EPLVQLDLLP LGSSHRESSS AALPSSWTGT CDGGRHVGGG GIDMNQIPSP ADFDDDAVVS  180
SPNSTVSSFQ MGPGSHATSG NKRERDDTNN SNSHELERAC SRASDEEDGE TTRKKLRLSK  240
EQSALLEESF KEHNTLNPKQ KLALAKQLSL RPRQVEVWFQ NRRARTKLKQ TEVDCEFLKR  300
CCESLTEENR RLQKEVQELR ALKVSHPFYM QLPAATLTMC PSCERVATAD THTTLSPWQA  360
LAPNTPRTLR S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152160GGRHVGGGG
2231237TRKKLRL
3281289RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1040550.0BT104055.1 Picea glauca clone GQ02805_O24 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265939.12e-94PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466655e-78HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A0C9QME41e-144A0A0C9QME4_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_22371_1708 transcribed RNA sequence
STRINGXP_010265939.16e-94(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-72homeobox from Arabidopsis thaliana