PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_56828g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 373aa    MW: 41190.6 Da    PI: 7.9341
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_56828g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-3943102362
         zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    +++lkcprCds ntkfCyynnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+rknk+++
  MA_56828g0010  43 QQTLKCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRKNKRTK 102
                    7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2742100IPR003851Zinc finger, Dof-type
PfamPF027018.8E-3344100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.68346100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MDSTDWQQQN GMQERGLKSP DDMMSACSRP LLERRPVKQP TDQQTLKCPR CDSPNTKFCY  60
YNNYSLSQPR HFCKTCRRYW TRGGALRNVP VGGGCRKNKR TKRGGLDIPG GGLTSSNSGN  120
PSSAHDLVTN PFHHTPNGSM YYGLPSSGNE ISLAFARIQQ AARLGDRSAM ANCKNSSDYN  180
LGRNTQSSIP SSHLSALSAL KSSQLSGLEF PIISGRQDQG SEDFCSFLET NPHMPGPINI  240
NPPLTATTSN LNMFTASEDH HGQNNIDSSI RWNRLNDQSR IPLALIHEGH HPDETQALAS  300
NFNGEHHHHT ISKSKVKTEE PENRLVSEWQ IIPGAAASET LFQTAGDNAD YWNGGAWPDL  360
MTSYIRGSPC HHC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC6886760.0KC688676.1 Pinus pinaster Dof1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLT2B6N60.0T2B6N6_PINPS; Dof1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-35Dof family protein