PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_55512g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 98aa    MW: 11088.5 Da    PI: 4.4316
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_55512g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260323.4e-1024062100
         DUF260  62 vyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                    v +A+ r+rdPvyG+vgvi++l++++++l+++la++++e
  MA_55512g0010   2 VHQARERIRDPVYGCVGVINDLKNKVSELQSQLASTQAE 40 
                    789*******************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.626141IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-8138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MVHQARERIR DPVYGCVGVI NDLKNKVSEL QSQLASTQAE VASITQQHAN LLTVIFGCHE  60
VLEPNFYIPS LEETEDTHMN APVADDVDPL QLWKPFWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LQI91e-30B8LQI9_PICSI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1626323
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-16LOB domain-containing protein 1