PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_55357g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 238aa    MW: 26818.1 Da    PI: 6.6122
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_55357g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.44.5e-42641641101
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaC++lrr+C ++Cvlapyfp ++p+kfa vh++FGasn++++l+++++e+r+d++ss+vyeA+ar+rdP+yG++g + +lqqq++ l+++la+
  MA_55357g0010  64 PCAACRTLRRRCGDKCVLAPYFPPNDPQKFATVHRVFGASNIIRILQDVDTEHRDDTVSSMVYEARARLRDPIYGCAGAVCQLQQQVCDLQSQLAT 159
                    7*********************************************************************************************** PP

         DUF260  97 lkeel 101
                    +++++
  MA_55357g0010 160 AQAQI 164
                    99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.40763164IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4164161IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MRQGWKMALD VQKGFDAAST RSHAHNTHII HSYDEITFND LANIRRLQIY KMSEGNPRTK  60
VATPCAACRT LRRRCGDKCV LAPYFPPNDP QKFATVHRVF GASNIIRILQ DVDTEHRDDT  120
VSSMVYEARA RLRDPIYGCA GAVCQLQQQV CDLQSQLATA QAQILNLHCQ QANLLAFLTD  180
NNSSFGKGGE TADYDYDEPL GSSWTDSPAS QVTDGEKDMN VLFQFQEMEM FTWSRNGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-406317110118LOB family transfactor Ramosa2.1
5ly0_B9e-406317110118LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1047710.0BT104771.1 Picea glauca clone GQ02814_K04 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022875086.19e-60LOB domain-containing protein 1-like
SwissprotQ9LQR03e-51LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A2Z7BKX03e-58A0A2Z7BKX0_9LAMI; LOB domain-containing protein 11-like
TrEMBLA0A3Q7J1V12e-58A0A3Q7J1V1_SOLLC; Uncharacterized protein
STRINGSolyc11g072470.1.15e-59(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-46LOB domain-containing protein 1