PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_52474g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 389aa    MW: 42231.2 Da    PI: 7.1367
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_52474g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-3966126262
         zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                    +e+a+kcprC+stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+++
  MA_52474g0010  66 AEQAQKCPRCESTNTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNVPVGGGCRKNKRTK 126
                    57899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2764124IPR003851Zinc finger, Dof-type
PfamPF027013.2E-3368124IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.12470124IPR003851Zinc finger, Dof-type
PROSITE patternPS01361072108IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
SYGVIQCVCI VFVCGDAPAA SVIIICVKRA KLEADQNAMQ ERGLKPPDDI MSCSRPLLDR  60
RLKPHAEQAQ KCPRCESTNT KFCYYNNYSL SQPRYFCKTC RRYWTKGGTL RNVPVGGGCR  120
KNKRTKRASD QPVSSQNDAS PSTNTTGCEG PSCPTMEEPS STVPGASTSI YYSIANEGDE  180
LAGYPYARAP LGGCNSNNNT GSLQPSLAPL GSLSSLNALQ SLKSSFPGLD LPSCSRPDQG  240
PLNISDLSCL FEAHHQQQQM NTSSSLPISH VSDVFNPFSL PVDALNSHDH HWRGLVQQQK  300
LGVPLEDGQV NMSPLGENIM EGLRPHQQKL RQNNNAKLED ENIRTSAPPV HWQVPPEGFF  360
EAGGDSGYWN GGGTWPDLSG YGPSSSPLI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1161071e-175BT116107.1 Picea glauca clone GQ03711_P05 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D6QVB31e-161A0A0D6QVB3_ARACU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.16e-34TARGET OF MONOPTEROS 6