PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_52027g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SBP
Protein Properties Length: 1002aa    MW: 111895 Da    PI: 7.6899
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_52027g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.8e-40140216278
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    Cqv++C+ dl++ak+yhrrhkvCe hska+++lv  ++qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+qa
  MA_52027g0010 140 CQVDDCRIDLTNAKDYHRRHKVCEPHSKASTALVGTVMQRFCQQCSRFHPLGEFDEGKRSCRRRLAGHNKRRRKTQA 216
                    **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.1E-33135201IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.607137214IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.72E-37138218IPR004333Transcription factor, SBP-box
PfamPF031102.4E-30140213IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.201.3E-7847951IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484039.17E-8848952IPR020683Ankyrin repeat-containing domain
CDDcd002049.49E-8848952No hitNo description
PROSITE profilePS502978.72886958IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1002 aa     Download sequence    Send to blast
MENEAGPRVA YFSHPFPPGG FAQQKHGGTY RHQARNAGWN ADSWEWDSLR FVAKPADEKS  60
HGREGSNVQN AEASSRILHL GTHDSTNMRP ENNKRKYSSE EEDAGNLTLK LGGSLYGDDS  120
NSKTNKRFRS GFVSSSYPLC QVDDCRIDLT NAKDYHRRHK VCEPHSKAST ALVGTVMQRF  180
CQQCSRFHPL GEFDEGKRSC RRRLAGHNKR RRKTQAEEIG CRGFMTGDEN GALRNFDIAS  240
LVAVLSHQHQ ASNSVDKLFD RRSLDKEHLI RCLSKLKSVP SLGDIGTTRP QLAIDLNVSQ  300
NMQPQAQAQD AKGKALQTND RQSPVPDSEM LRILSTLTER SPEALSLLQR SLMAQKTLNS  360
HNSYDQQTIS QQFLNISPTL IASRDIDHVA ISDGHENISK NSLSRGNLAW PVHHFNSSDG  420
MHNPNLVVSK QYFKEDSCNP LEERFSSRSP SLSPPVVQKL FPLHSKDENK EIDSVSVCEE  480
DELTPDQSPK DDGLCKFGLS NSGRRNDRHN ISLSSPPAAS DLRINGYTSS GSDQSPTSSN  540
SDTKERTSRI IFKLFGKDPS DFPQTLRTQI LEWLSHCPSD MESYIRPGCV ILTIFASMPM  600
AAWEQASKRG LARTDGKIRF CRSSSSLDAP EICSVWPIAV VAGEETRLVL RGHNLTTPGT  660
KILCAYRGKY ISQNVPEDYQ VGSSAFFSNA TTIEHKFPGG PANVFGRFFM EVERGFKGNN  720
FPVIVADSAI CRELRTLEGE FEGICEGKVI DWHSKPHSRE DVVFGIQEDV VTFLNELGWL  780
FQRNSYLKEG LFSPKDAPAR FKFLLTYAVE RNWNSLLKKV LDILFIMYGE EEGSVREAFS  840
ILSEIDLLHR AVKRNCRQVV DMLLCYVPSS SADRNIAFRP DVIGPGGLTP LHLAASMQNA  900
EDVVDALTND PQKIGLQAWT TALDANQQTP HAYALMRNNH TYNRLVLEKM ADQRRAQAGP  960
WNLDVTGFLP GTLQNIKVPP AFIASLSGAQ GLLEIEKRPN QI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-31134213584squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1046821e-155BT104682.1 Picea glauca clone GQ02813_H16 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9S2R60.0A0A0C9S2R6_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_18703_5262 transcribed RNA sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP71381115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.11e-170squamosa promoter binding protein-like 14