PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_47951g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Trihelix
Protein Properties Length: 649aa    MW: 73273.9 Da    PI: 7.512
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_47951g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix96.62.3e-30151235187
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                    rW++qe+laL+++r+em+ ++r+++lk+plWe+vs++++e g+ rs+k+Ckek+en++k+yk++keg+ +r++++s  +++f+qlea
  MA_47951g0010 151 RWPRQETLALLKIRSEMDANFRDASLKGPLWEDVSRRLAELGYYRSAKKCKEKFENVHKYYKRTKEGRAGRQDGKS--YRFFTQLEA 235
                    8*********************************************************************866665..*******85 PP

2trihelix104.39.1e-33441526187
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                    rW+k evl+Li++r+ +e+r+ +   k plWee+s++m+  g++rs+k+Ckekwen+nk+++k ke++kkr +e+ +tcpyf+ql+a
  MA_47951g0010 441 RWPKPEVLTLIKLRSGLEQRFHEPGPKSPLWEEISAAMANLGYNRSAKRCKEKWENINKYFRKAKESNKKR-PENAKTCPYFHQLDA 526
                    8*********************************************************************8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0011148210IPR001005SANT/Myb domain
PfamPF138373.6E-21150236No hitNo description
CDDcd122033.24E-26150215No hitNo description
PROSITE profilePS500906.69150208IPR017877Myb-like domain
PROSITE profilePS500907.108434498IPR017877Myb-like domain
SMARTSM007178.2E-4438500IPR001005SANT/Myb domain
PfamPF138377.4E-23440527No hitNo description
CDDcd122036.67E-29440505No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MQSTSQYGVP EVPAQFVVGR VPSSGAHSHI FSLAHDMSLS PKNSSPHPQP QSHQSSEQQH  60
HGSNQQMIAH KIRLESDSPE VAAPSPGHPK LNKSSNTTTN NYSSSNHNIN TISTDNYNKQ  120
QQQQQQEIVQ LGGDEDVLGS EDCERGSAGN RWPRQETLAL LKIRSEMDAN FRDASLKGPL  180
WEDVSRRLAE LGYYRSAKKC KEKFENVHKY YKRTKEGRAG RQDGKSYRFF TQLEALYGGS  240
SSGNLNNMNS NNNKVTVAIS GGSAAPVGSL SIVAAPHVNQ ESREIDNSIA VKAAAKPVNQ  300
TLELSTVAAM SFSSSDSSED EYDEPEDHDH NRKRKRPSSS SSSESMVLFF ENLMKQVIEK  360
QEAMQRKFLE AIEKREQDRM IREEAWKRQE MARLSREQEL KSQERSLSAS RDAALVAFLQ  420
KVVVHHEDIK DLSSFDPNSK RWPKPEVLTL IKLRSGLEQR FHEPGPKSPL WEEISAAMAN  480
LGYNRSAKRC KEKWENINKY FRKAKESNKK RPENAKTCPY FHQLDALYKK RNLANRQNKI  540
MEKDSMVNGN DQKVEDQETE ELVEHEQPSG SNRENTHDHH SHNQQGDHGA DILAVMPSAQ  600
GEPHAYNHER TNPNSSSTTR DASSFMAMVH KLTSDHPPEF NMSTSSNTE
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1155150.0BT115515.1 Picea glauca clone GQ03619_G22 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024402443.11e-154trihelix transcription factor GTL1-like
TrEMBLA0A0D6QXM91e-160A0A0D6QXM9_ARACU; Uncharacterized protein
STRINGPP1S19_341V6.11e-153(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.24e-62Trihelix family protein