PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_4774g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TCP
Protein Properties Length: 557aa    MW: 60521.1 Da    PI: 8.46
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_4774g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP99.46.4e-31802112130
           TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaaksk 98 
                   +g+kdrhsk+ T++g+RdRRvRls+++a++++dLq++LG+d++sk++ WL+++a+ ai+el+ ++ +  s++ ++  + ++sn s+++++  ++ ++
  MA_4774g0010  80 TGGKDRHSKVITAKGLRDRRVRLSVPTAIQLYDLQERLGYDQPSKAVGWLIKAAESAIDELPVLNPEMDSASADNVAQLNSSNCSNADHCVGSPRES 176
                   689*************************************************************333333333333333333333334444443222 PP

           TCP  99 ksqksaasalnlak.esrakarar..arertrekm 130
                    +    +++ ++     +aka+ r   +  +re m
  MA_4774g0010 177 ATAVTGSAFTAFRVgLGSAKAQGRnsHKAINREPM 211
                   22222222222222222233333311222344444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.3E-2881204IPR005333Transcription factor, TCP
PROSITE profilePS5136931.44682140IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MVSNSSQDLE AWFIKVNNRE PEMEIQNKDL AAFSESMNKG RLQEDSDKTQ GNGKGSKRKA  60
WKMEGKVEQE WKIVSVSRLT GGKDRHSKVI TAKGLRDRRV RLSVPTAIQL YDLQERLGYD  120
QPSKAVGWLI KAAESAIDEL PVLNPEMDSA SADNVAQLNS SNCSNADHCV GSPRESATAV  180
TGSAFTAFRV GLGSAKAQGR NSHKAINREP MSIATLRGSD LGRSSSSISD GSIKGSAEHT  240
SNCSVSEPLR GSDLGRSSSS ISDGSIKGSA EHTSNCSVSE PTSRIEARLK ASELATKKSV  300
SAKNSGGGSP PAIDQLNSMQ PFLTSYMLKS IFPDTPLLFE SKFSKDNNPC GIHTQILSGT  360
DNVQQLWDYN SRPSYTDMLC TRDSHQLQDL ASSSTAPLQK SFPRVPSTPG SHIGNSCLQS  420
YEMADSAISF FDPKQSRPFG GNAEQGQANL SYSNFPNMIT KRVEQQRQQQ AQMHIKHYAS  480
TIVPTFSNDI NFLTSSLSSR EPHQSISSSI TNMPSLSHTH KNAYGEASAN AAHDFVPSQD  540
YEARVFPGFQ YAGQRKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A3e-2187141155Putative transcription factor PCF6
5zkt_B3e-2187141155Putative transcription factor PCF6
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1186060.0BT118606.1 Picea glauca clone GQ04008_C12 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.22e-32TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2