PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_47367g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SBP
Protein Properties Length: 676aa    MW: 73430.8 Da    PI: 8.85
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_47367g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.1e-40209286178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cq+egC+adl++ak+yhrrhkvCe+hska++v++ g++qrfCqqCsrfh l efDe krsCr+rLa+hn+rrrk+q+
  MA_47367g0010 209 RCQAEGCKADLTNAKHYHRRHKVCEFHSKATSVVTGGVQQRFCQQCSRFHVLAEFDEVKRSCRKRLADHNRRRRKPQT 286
                    6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.6E-34204271IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.667207284IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.8E-39208289IPR004333Transcription factor, SBP-box
PfamPF031108.9E-31210283IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MTFCQCGIWS SVHVSAESGL DSTRLDFSKD GLKRGLKARQ AEGRPRICVG VVGIERRRSD  60
GRIGLAALRG GIVCGHQNHA LGLLNSSGIR SFDGSNDGMN PPAPPSSFHP GLLYSEMPGF  120
SAGGFGCGDS RSQLLGMMSM QQQAEHHHHH HKEGGFHDIV KREELCPGDF QARIGLNLGH  180
RTYFSAEDTA VSRLYKRPRA IPPASQVPRC QAEGCKADLT NAKHYHRRHK VCEFHSKATS  240
VVTGGVQQRF CQQCSRFHVL AEFDEVKRSC RKRLADHNRR RRKPQTNTIV PAVSSAEAAT  300
ALKVEDDSNN VSGSCNNTSR GTVQASAAAA AAPVLRTEAQ ALLNAMSLPL ILQNTKGSQM  360
NNNTNTTTAN NNNNPMLQQA NSQKVTVANQ QYVQQQQSGG GGHKGPNLSL SSSSVGMSLC  420
NPRQTTAQDY SGLELALPWL RTTSEYSGSN HRPPPAMDNI LHPIISHEKS NVEAFSASSV  480
QNFLPLSGSM SSRELGSSQW MVGSSDSASS LEAGQQMFSL LEPAEHQNRT EEQPQTARPV  540
EYLSHRHQGG LNNKEPVDGN SEAKFSGMQN SLRPSLILIG LIDEPVELLG LASPKSMPRV  600
SGTIAVTSAY LILFRQAMRR LHCLIEFRSL AMIIIRAIPL LLNSTLHFSI FCGVKSCNSS  660
PILDNEAPGL FVLVHE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-292102831184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1266283KRSCRKRLADHNRRRRKP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0607593e-97FJ060759.1 Pinus taeda isolate 5683 anonymous locus 0_16866_02 genomic sequence.
GenBankFJ0607653e-97FJ060765.1 Pinus taeda isolate 5692 anonymous locus 0_16866_02 genomic sequence.
GenBankFJ0607663e-97FJ060766.1 Pinus taeda isolate 5688 anonymous locus 0_16866_02 genomic sequence.
GenBankFJ0607673e-97FJ060767.1 Pinus taeda isolate 5695 anonymous locus 0_16866_02 genomic sequence.
GenBankFJ0607683e-97FJ060768.1 Pinus taeda isolate 5700 anonymous locus 0_16866_02 genomic sequence.
GenBankFJ0607693e-97FJ060769.1 Pinus taeda isolate 5694 anonymous locus 0_16866_02 genomic sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.19e-51squamosa promoter binding protein-like 8