PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_459791g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Dof
Protein Properties Length: 301aa    MW: 32667.4 Da    PI: 9.312
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_459791g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-393393262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +e+alkcprCdstntkfCyynnyslsqPr+fCk+CrryWtkGG+lr vPvGgg+rknk+++
  MA_459791g0010 33 PEQALKCPRCDSTNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGTLRTVPVGGGCRKNKRAK 93
                    7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-283291IPR003851Zinc finger, Dof-type
PfamPF027011.4E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3573791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MLGMMQERGF RPSGEDLLSC SRPLLERRLK HQPEQALKCP RCDSTNTKFC YYNNYSLSQP  60
RHFCKTCRRY WTKGGTLRTV PVGGGCRKNK RAKRPVAAEQ PIKNKRAKRP VAAEQPMFST  120
QSEPSTSATP SASALPIALD HQTDLNPATN SSSYFNLPAN STTGPTEANL AFARIQQAAR  180
HGGRSVLPNC NNSDFLGLSC GSTTQSSFGP QNSLNSLNPI SSLTNLSALS ALNSLKFSFA  240
GLEDFPVNSN RSDQGSLAVP SEWQIPSEST LFEQAGDSTN YWSGGAWGDL TSYGSSVSPQ  300
I
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1109070.0BT110907.1 Picea glauca clone GQ03229_K18 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLT2B7740.0T2B774_PINPS; Dof6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.15e-36TARGET OF MONOPTEROS 6