PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_451290g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 188aa    MW: 20795.7 Da    PI: 8.2151
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_451290g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.7e-42181181101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaC++lrr+C ++Cvlapyfp ++p+kfa vh++FGasn++++l+++  e+r+da+ss+vyeA+ar+rdPvyG++gv+ +lqqq+++l+++la
  MA_451290g0010  18 PCAACRTLRRRCGDKCVLAPYFPPNDPQKFATVHRVFGASNIIRILQDVGIEHRDDAVSSMVYEARARLRDPVYGCAGVVCQLQQQVCNLQSQLA 112
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++++++
  MA_451290g0010 113 TAQAQI 118
                     *99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.42517118IPR004883Lateral organ boundaries, LOB
PfamPF031959.1E-4218115IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
FIRPAMREGK PRTKVATPCA ACRTLRRRCG DKCVLAPYFP PNDPQKFATV HRVFGASNII  60
RILQDVGIEH RDDAVSSMVY EARARLRDPV YGCAGVVCQL QQQVCNLQSQ LATAQAQILN  120
LHCQQGNLLE FLTASISSLG KGGQTAGHDH DEPLGSSWTD SPASQVTDGQ KDTDFLLQEM  180
FMWSRYGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-401812511118LOB family transfactor Ramosa2.1
5ly0_B7e-401812511118LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1047710.0BT104771.1 Picea glauca clone GQ02814_K04 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009611728.19e-59PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016497689.19e-59PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-52LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A2Z7BKX01e-57A0A2Z7BKX0_9LAMI; LOB domain-containing protein 11-like
STRINGXP_009611728.14e-58(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-46LOB domain-containing protein 1