PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_445236g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 234aa    MW: 25881.1 Da    PI: 6.3882
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_445236g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.85.1e-40761751100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck++r+kC+++Cvlapyfp+++p kf  vhk+FG+ +v+k l++lp e+r da++s+vyeA  r+rdPv+G++gvi++lq+++ +l+ +la
  MA_445236g0010  76 PCAGCKIQRKKCTENCVLAPYFPQSDPDKFLLVHKVFGNGHVIKSLQELPAEQRGDAVNSMVYEASQRIRDPVHGCAGVINDLQNKITELQLQLA 170
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  MA_445236g0010 171 STQAE 175
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.2004.9E-42080IPR000209Peptidase S8/S53 domain
PROSITE patternPS0013802737IPR023828Peptidase S8, subtilisin, Ser-active site
PROSITE profilePS5089125.39775176IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3876173IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0004252Molecular Functionserine-type endopeptidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MALRFPSLST TMAGNRFRRN FSEIMAGTSD AAPATAGTVN VLKGQHKLWN QDFQKTANTM  60
VKNMSDNASK PGSMSPCAGC KIQRKKCTEN CVLAPYFPQS DPDKFLLVHK VFGNGHVIKS  120
LQELPAEQRG DAVNSMVYEA SQRIRDPVHG CAGVINDLQN KITELQLQLA STQAELANIN  180
MQHANLFTLV TGSHEASDPN FYCVSPQGSE DTDAQSMVVD EEDHPLQFWE SFWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-35691764111LOB family transfactor Ramosa2.1
5ly0_B2e-35691764111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027347331.15e-51LOB domain-containing protein 1-like
SwissprotQ9LQR01e-49LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB8LQI94e-75B8LQI9_PICSI; Uncharacterized protein
STRINGGorai.012G094200.14e-50(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-52LOB domain-containing protein 1