PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_419570g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family M-type_MADS
Protein Properties Length: 359aa    MW: 41109.4 Da    PI: 5.9061
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_419570g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF368.7e-123331343
                    HHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF 13 fskRrngilKKAeELSvLCdaevaviifsst 43
                    f kR++g+ KK +ELS+LC++e++++ f+++
  MA_419570g0010  3 FMKRKKGLEKKVKELSILCGVEACMVCFGPQ 33
                    99**************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006610.905131IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-14384IPR002100Transcription factor, MADS-box
CDDcd002667.70E-15373No hitNo description
PfamPF003199.5E-12333IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MRFMKRKKGL EKKVKELSIL CGVEACMVCF GPQMDQQTTS DHHDVWPGKS KALDIVERYR  60
NLSKEEQDKK KLDNTSFLEQ RIKKLKVELS TKRKENRDLD MEAVYPWDTC LNFFSAEQLR  120
DLVDYIDIRL ETVHERINFL SRDKREISNG AESDIIQLRE LECSARQPVE GGGSYNFKMP  180
YQSCHESLSS SVGNLKPYLS LEGHYKAFMS SCETAAIDYY SKVNLPFITD LKDYHPPNHK  240
EATGNDEEDR MAVNNAHLIA NESFPLFGID GVNPIQSSTG SCSPWCCTIT PCSLHNPLYS  300
TCPQHYGMNP TIQQVHFSCE PQHRQWMDEM MESHTIQKVL GDEGTDFQNN NSVGPTTLL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1245671e-169BT124567.1 Picea sitchensis clone WS0475_C11 unknown mRNA.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G27810.13e-13M-type_MADS family protein