PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_361391g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 180aa    MW: 20056.6 Da    PI: 6.6607
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_361391g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.41.9e-41221211100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++++kC+++Cvlapyfp+++p+kf  vh+lFG+ +v+kll++lp e+r da+sslvyeA+ara dPv+G++gvi+ lqq++e+++a+la
  MA_361391g0010  22 ACAACKFQKKKCSEKCVLAPYFPQNDPNKFLLVHRLFGNGHVVKLLQDLPAEQRGDAVSSLVYEARARAADPVHGCAGVINGLQQRIEEVQAQLA 116
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      ++++
  MA_361391g0010 117 FTQAK 121
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.44421122IPR004883Lateral organ boundaries, LOB
PfamPF031959.7E-4022119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MRAGTLFPAE RSQQVLSKAE TACAACKFQK KKCSEKCVLA PYFPQNDPNK FLLVHRLFGN  60
GHVVKLLQDL PAEQRGDAVS SLVYEARARA ADPVHGCAGV INGLQQRIEE VQAQLAFTQA  120
KLDNITVQHS NILITLNNTR YHQGWDPNFY SPSSQASQDT QYSNPPVLDD EVDSLQLWET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-32191158104LOB family transfactor Ramosa2.1
5ly0_B3e-32191158104LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008224697.12e-45PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR07e-43LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB8LQI92e-61B8LQI9_PICSI; Uncharacterized protein
STRINGXP_008224697.19e-45(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-38LOB domain-containing protein 1