PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_35037g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 154aa    MW: 17163.5 Da    PI: 4.6633
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_35037g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26080.92e-25331285100
         DUF260   5 CkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                    Ck+ +++C+++ ++   +++++ +kfa+++++FGa nv+kl+++lp ++r +a++s+vyeA ar+++P  G++g+i++lq+q++ l++++ +++++
  MA_35037g0010  33 CKMEQKECKDNSTILYRIASHDLHKFAILQEVFGACNVIKLIQDLPSDQRVEAIDSMVYEASARLQEPALGCAGIIQQLQRQISDLESQITSTQAR 128
                    *************99999***********************************************************************9998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.88928129IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-2433126IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MKGAMWDPGV VVQMGNTEEK PRILSPSAAF HDCKMEQKEC KDNSTILYRI ASHDLHKFAI  60
LQEVFGACNV IKLIQDLPSD QRVEAIDSMV YEASARLQEP ALGCAGIIQQ LQRQISDLES  120
QITSTQARIQ KIHCQQAELV AFIPGFNSTS EDDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-19211366118LOB family transfactor Ramosa2.1
5ly0_B1e-19211366118LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9P1U34e-57A9P1U3_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.17e-32LOB domain-containing protein 11