PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_33594g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family G2-like
Protein Properties Length: 468aa    MW: 51128.4 Da    PI: 6.8973
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_33594g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.61.2e-32232287156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  MA_33594g0010 232 KARRCWSPELHRRFVNALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 287
                    68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-29229290IPR009057Homeodomain-like
PROSITE profilePS5129413.977229289IPR017930Myb domain
SuperFamilySSF466898.96E-18230290IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-27232287IPR006447Myb domain, plants
PfamPF002491.8E-7234285IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MHLLNDAIAA SKEQLTDCQP SVQAPRPVQQ AGFQFEEEQY NRPVLEELIP IKKRCDESGD  60
ESPENNQNDS KRTKFANECK KEKSSSPEEP LKQHDSQLRS DQEQLFPTNS SLFSDSKQRI  120
GGAFLPFSRE RQSNPSVSAR SNAVKHPPDL ALSSAEQEVG STFRCNETAT MNNVTTMNNV  180
TTTSLSRSKE PTETTVPTPQ KEVVVKPNGG VCAVPTPAAS NATQSGGQSQ RKARRCWSPE  240
LHRRFVNALQ QLGGSQVATP KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PSPSPPTPAS  300
QAPQLVVLGG IWVPPEYAAH AAVAAHQGPG LYGTLSNTTS SHSQSHYCQS PMPQEHYSQM  360
NMSSQLQLPQ PAYCEQQQTP SQSLSSPQGP LQLTGQSSGA RGTSVDGGRE ESVGEDGKSE  420
SSSWKGEEIA KNVEARNMGR GLSLRKQPLQ SVDGDEEDSR GSETTLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14232285154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14232285154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14232285154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14232285154Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1135130.0BT113513.1 Picea glauca clone GQ03411_M24 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A171NYB90.0A0A171NYB9_TAXWC; GARP2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-44G2-like family protein