PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_328535g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family LBD
Protein Properties Length: 195aa    MW: 21189.8 Da    PI: 4.3972
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_328535g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26072.86.7e-2365153999
          DUF260   9 rrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                     +++C ++C+l   f++++ +kfa+++++FGa nv+kl  +lp ++r +a++s+vyeA ar++dP  G++g+i++lq+ql+ l++++ ++++
  MA_328535g0010  65 QNECLENCTLLYQFASNDLHKFAILQQVFGACNVVKL--DLPSDQRVEAIDSMVYEASARLEDPAFGCTGIIHQLQRQLSDLHSQITTTQA 153
                     569*********************************8..899*******************************************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.31956155IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-2165152IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MGLPIPLIGG AEVLVIASNM FEMSNSKEKQ SMGGDMDGSK IQKQKECLEK PSIGADADDS  60
KLEKQNECLE NCTLLYQFAS NDLHKFAILQ QVFGACNVVK LDLPSDQRVE AIDSMVYEAS  120
ARLEDPAFGC TGIIHQLQRQ LSDLHSQITT TQATIQKVRS QQAALLASVA GFNTAGEDVD  180
KFNPTSSASP KDYDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-19511486104LOB family transfactor Ramosa2.1
5ly0_B3e-19511486104LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9P1U39e-55A9P1U3_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-27LOB domain-containing protein 11