PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_3179g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family SBP
Protein Properties Length: 619aa    MW: 67292.6 Da    PI: 7.2008
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_3179g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.52.5e-40272349178
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   +Cq+egC+adls+ak+yhrrhkvCe hska++v+  gl+qrf qqCsrfh l efDe+krsCr+rLa+hn+rrrk+q+
  MA_3179g0020 272 RCQAEGCKADLSTAKHYHRRHKVCELHSKAATVVSGGLTQRFSQQCSRFHVLAEFDEGKRSCRKRLADHNRRRRKPQP 349
                   6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-34266334IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.487270347IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-37271352IPR004333Transcription factor, SBP-box
PfamPF031104.2E-29273346IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MNPPESTENQ GDQISWVWDH SQQHHHHHHQ SHNHNHPAAA VTMSIGLETR QFQGGGRVLE  60
YDWGSTPVLL SGGQGIPQDT EERKPQMISA AGSVMDTIQY SGNGNGNVNL AVNGMLSSGF  120
GHNIISPNSM GNLLMSSSAG TRNAYGGHNN HQHHHHHNNH HVLDSIRSSS PSSLLYSGGH  180
SGLSGFGNGY NDSNRAALEE HRHHILGLMG MDQKNMFHNI VKREDLCAGD FQARIGLNLG  240
LGGRTYFSSE DNIVNRLYKR PRAISPGSQV PRCQAEGCKA DLSTAKHYHR RHKVCELHSK  300
AATVVSGGLT QRFSQQCSRF HVLAEFDEGK RSCRKRLADH NRRRRKPQPN AVVTVSNTES  360
SSALKNTDQD QDTNSGSNQS SLQQPEQISR SEAPGLLTGI SLSQSLPLVL QTSKGQEQYL  420
QQTGPNLSLG GEIALDYPRH STGGENYSGL EIPIPWLRPA GSGSEFGGSE KNSSNGQVSE  480
SGGGGGSSST VQVFTSIQNL LPLPLQSSTE LGNSDWMVNG NLSGSSSRGQ HYGPADLNLH  540
SSLEGQQMLS LLEKDVRSSN VDTDRHNTED AVEYFSQQQG LSSKHSVDGH SEHRNQLSTS  600
FSGIQSLRSL SQSMYQNIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-282733461184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1329346KRSCRKRLADHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1005400.0BT100540.1 Picea glauca clone GQ0024_I12 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-52squamosa promoter binding protein-like 8